Record in detail


General Info

  • lamp_id:L01A002533
  • Name:Beta defensin 3
  • FullName:Beta defensin 3
  • Source:Equus caballus (horse)
  • Mass:3634.3 Da
  • Sequence Length:36 aa
  • Isoelectric Point:8.89
  • Activity:Antimicrobial
  • Sequence
        NSVTCSKNGGFCISPKCLPGSKQIGTCSLPGSKCCK
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002533    From 1 To 36 E-value: 0.00000000000001 Score: 70.5
        NSVTCSKNGGFCISPKCLPGSKQIGTCSLPGSKCCK
  • 2. L03A000254    From 27 To 62 E-value: 0.0000000000009 Score: 63.9
        TSFSCSQNGGFCISPKCLPGSKQIGTCILPGSKCCR
  • 3. L01A002509    From 1 To 36 E-value: 0.000000000001 Score: 63.9
        NSVTCSKNGGFCISPKCPPGMKQIGTCGLPGSKCCR
  • 4. L05ADEF309    From 7 To 42 E-value: 0.000000000002 Score: 62.4
        TSFSCSQNGGFCISPKCLPGSKQIGTCILPGSKCCR
  • 5. L01A002918    From 1 To 35 E-value: 0.000000000004 Score: 62
        SFSCSQNGGFCISPKCLPGSKQIGTCILPGSKCCR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: