Record in detail


General Info

  • lamp_id:L01A002541
  • Name:beta defensin 1
  • FullName:beta defensin 1
  • Source:Gorilla gorilla (Western Gorilla)
  • Mass:3835.4 Da
  • Sequence Length:36 aa
  • Isoelectric Point:8.37
  • Activity:Antimicrobial
  • Sequence
        DHYNCVSSGGQCLYSACPIFTKIQGTCYGGKAKCCK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000291    From 33 To 68 E-value: 9e-17 Score: 77.4
        DHYNCVSSGGQCLYSACPIFTKIQGTCYGGKAKCCK
  • 2. L01A002541    From 1 To 36 E-value: 4e-16 Score: 75.1
        DHYNCVSSGGQCLYSACPIFTKIQGTCYGGKAKCCK
  • 3. L01A001361    From 33 To 68 E-value: 7e-16 Score: 74.3
        DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
  • 4. L07APD0033    From 8 To 43 E-value: 0.000000000000002 Score: 73.2
        DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
  • 5. L01A001450    From 1 To 36 E-value: 0.000000000000002 Score: 72.8
        DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: