Record in detail


General Info

  • lamp_id:L01A002542
  • Name:[133778666]beta defensin 4 [Bos taurus]
  • FullName:[133778666]beta defensin 4 [Bos taurus]
  • Source:Bos taurus (cattle)
  • Mass:3625.3 Da
  • Sequence Length:32 aa
  • Isoelectric Point:9
  • Activity:Antimicrobial
  • Sequence
        NPQSCRWNMGVCIPISFLVNMRQIGTCFGPRV
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002542    From 1 To 32 E-value: 0.00000000000003 Score: 68.9
        NPQSCRWNMGVCIPISFLVNMRQIGTCFGPRV
  • 2. L01A000365    From 5 To 36 E-value: 0.00000000001 Score: 60.1
        NPQSCRWNMGVCIPISCPGNMRQIGTCFGPRV
  • 3. L12A09900|    From 6 To 37 E-value: 0.00000000001 Score: 60.1
        NPQSCRWNMGVCIPISCPGNMRQIGTCFGPRV
  • 4. L03A000267    From 27 To 58 E-value: 0.00000000001 Score: 60.1
        NPQSCRWNMGVCIPISCPGNMRQIGTCFGPRV
  • 5. L01A002594    From 1 To 32 E-value: 0.00000000002 Score: 60.1
        NPQSCRWNMGVCIPISCPGNMRQIGTCFGPRV

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: