Record in detail


General Info

  • lamp_id:L01A002544
  • Name:Defensin beta 1
  • FullName:Defensin beta 1
  • Source:Bos taurus (cattle)
  • Mass:3976.7 Da
  • Sequence Length:36 aa
  • Isoelectric Point:9.28
  • Activity:Antimicrobial
  • Sequence
        NPLSCRLNRGICVPIRCPGNLRQIGTCFTPSVKCCR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000263    From 27 To 62 E-value: 4e-16 Score: 75.1
        NPLSCRLNRGICVPIRCPGNLRQIGTCFTPSVKCCR
  • 2. L01A002946    From 1 To 36 E-value: 0.000000000000002 Score: 72.8
        NPLSCRLNRGICVPIRCPGNLRQIGTCFTPSVKCCR
  • 3. L01A002544    From 1 To 36 E-value: 0.000000000000002 Score: 72.8
        NPLSCRLNRGICVPIRCPGNLRQIGTCFTPSVKCCR
  • 4. L12A09088|    From 27 To 62 E-value: 0.000000000000005 Score: 71.6
        NPLSCRLNRGICVPIRCPGNLRQIGTCFRPSVKCCR
  • 5. L12A09074|    From 27 To 62 E-value: 0.000000000001 Score: 63.5
        NPLSCRRNKGICLPIRCPGSMRQIGTCFGPRVKCCR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: