Record in detail


General Info

  • lamp_id:L01A002546
  • Name:similar to beta-defensin 2
  • FullName:similar to beta-defensin 2
  • Source:Bos taurus (cattle)
  • Mass:3944.6 Da
  • Sequence Length:36 aa
  • Isoelectric Point:8.61
  • Activity:Antimicrobial
  • Sequence
        DSYICARKGGTCNLSPCPLYNRVEGTCYRGKAKCCI
  • Function:

Cross-Linking

  •   Cross-linking

  •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002546    From 1 To 36 E-value: 4e-16 Score: 75.1
        DSYICARKGGTCNLSPCPLYNRVEGTCYRGKAKCCI
  • 2. L01A002547    From 1 To 36 E-value: 5e-16 Score: 74.7
        DSYICARKGGTCNLSPCPLYNRIEGTCYRGKAKCCI
  • 3. L01A002561    From 1 To 36 E-value: 0.00000000000004 Score: 68.6
        DHYICAKKGGTCNFSPCPLFNRIEGTCYSGKAKCCI
  • 4. L02A001590    From 1 To 36 E-value: 0.00000000000005 Score: 68.2
        DHYICAKKGGTCNFSPCPLFNRIEGTCYSGKAKCCI
  • 5. L05ADEF310    From 33 To 68 E-value: 0.00000000000006 Score: 68.2
        DQYICARKGGTCNFSPCPLFTRIDGTCYRGKAKCCM

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: