Record in detail


General Info

  • lamp_id:L01A002554
  • Name:Beta defensin 2
  • FullName:Beta defensin 2
  • Source:Equus caballus (horse)
  • Mass:3718.5 Da
  • Sequence Length:36 aa
  • Isoelectric Point:8.91
  • Activity:Antimicrobial
  • Sequence
        NPISCARNRGVCIPIGCLPGMKQIGTCGLPGTKCCR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002554    From 1 To 36 E-value: 0.000000000000003 Score: 72
        NPISCARNRGVCIPIGCLPGMKQIGTCGLPGTKCCR
  • 2. L01A000519    From 5 To 40 E-value: 0.000000006 Score: 51.2
        NSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCK
  • 3. L05ADEF106    From 4 To 39 E-value: 0.000000006 Score: 51.2
        NSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCK
  • 4. L03A000268    From 27 To 62 E-value: 0.000000007 Score: 51.2
        NSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCK
  • 5. L01A002509    From 1 To 36 E-value: 0.000000007 Score: 51.2
        NSVTCSKNGGFCISPKCPPGMKQIGTCGLPGSKCCR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: