Record in detail


General Info

  • lamp_id:L01A002555
  • Name:sperm-associated antigen 11 variant C isoform 1
  • FullName:sperm-associated antigen 11 variant C isoform 1
  • Source:Rattus norvegicus (Norway rat)
  • Mass:3956.6 Da
  • Sequence Length:34 aa
  • Isoelectric Point:8.38
  • Activity:Antimicrobial
  • Sequence
        QIVNCKKNEGFCQKYCNFMETQVGYCSKKKEACC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002555    From 1 To 34 E-value: 0.00000000000003 Score: 68.9
        QIVNCKKNEGFCQKYCNFMETQVGYCSKKKEACC
  • 2. L01A000194    From 18 To 51 E-value: 0.000000000003 Score: 62.4
        RIVDCKRSEGFCQEYCNYLETQVGYCSKKKDACC
  • 3. L01A002596    From 1 To 34 E-value: 0.00000000001 Score: 60.5
        RIVDCKRSEGFCQEYCNYLETQVGYCSKKKDACC
  • 4. L01A002500    From 1 To 32 E-value: 0.00000000004 Score: 58.5
        VDCRRSEGFCQEYCNYMETQVGYCSKKKDACC
  • 5. L01A002432    From 18 To 51 E-value: 0.00000000005 Score: 58.2
        KVVDFRRSEGFCQEYCNYMETQVGYCPKKKDACC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: