Record in detail


General Info

  • lamp_id:L01A002558
  • Name:beta defensin
  • FullName:beta defensin
  • Source:Capra hircus ( goat )
  • Mass:4097.8 Da
  • Sequence Length:36 aa
  • Isoelectric Point:9.93
  • Activity:Antimicrobial
  • Sequence
        NHRSCHRIKGVCAPDRCPRNMRQIGTCFGPPVKCCR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002558    From 1 To 36 E-value: 3e-16 Score: 75.5
        NHRSCHRIKGVCAPDRCPRNMRQIGTCFGPPVKCCR
  • 2. L03A000260    From 27 To 62 E-value: 0.0000000000001 Score: 67
        NHRSCYRNKGVCAPARCPRNMRQIGTCHGPPVKCCR
  • 3. L12A04055|    From 10 To 45 E-value: 0.0000000000002 Score: 66.6
        NHRSCYRNKGVCAPARCPRNMRQIGTCHGPPVKCCR
  • 4. L01A002920    From 1 To 36 E-value: 0.0000000000002 Score: 66.2
        NHRSCYRNKGVCAPARCPRNMRQIGTCHGPPVKCCR
  • 5. L01A001367    From 1 To 36 E-value: 0.0000000000002 Score: 65.9
        NHRSCYRNKGVCAPARCPRNMRQIGTCHGPPVKCCR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: