Record in detail


General Info

  • lamp_id:L01A002559
  • Name:antibacterial peptide chensirin-2
  • FullName:antibacterial peptide chensirin-2
  • Source:Rana chensinensis (Chinese brown frog )
  • Mass:7006.1 Da
  • Sequence Length:59 aa
  • Isoelectric Point:4.79
  • Activity:Antimicrobial
  • Sequence
        MFTLKKSLLLLFFLGTISLSLCEEERNAEEERRDYPEERDVEVEKRIIPLPLGYFAKKT
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002559    From 1 To 59 E-value: 7e-29 Score: 117
        MFTLKKSLLLLFFLGTISLSLCEEERNAEEERRDYPEERDVEVEKRIIPLPLGYFAKKT
  • 2. L12A07102|    From 1 To 57 E-value: 2e-27 Score: 112
        MFTLKKSLLLLFFLGTISLSLCEEERNAEEERRDYPEEKDVEVEKRIIPLPLGYFAK
  • 3. L12A07168|    From 1 To 58 E-value: 4e-18 Score: 81.6
        MFTLKKSMLLLFFLGTINLSLCEQERNADEEERRDNPDEMDVVVEKRFLPLLAGLAAN
  • 4. L01A003834    From 1 To 58 E-value: 6e-18 Score: 81.3
        MFTFKKSMLLLFFLGTINLSLCEQERNADEEERRDDPDETNVEVEKRFLPLLAGVVAN
  • 5. L12A07345|    From 1 To 54 E-value: 1e-16 Score: 77
        MFTMKKSMLLLFFLGTINLSLCEQERDAEEERRDDEDKRDVEVEKR---FALGAVTK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: