Record in detail


General Info

  • lamp_id:L01A002564
  • Name:TPA_exp: DEFB4-like protein
  • FullName:TPA_exp: DEFB4-like protein
  • Source:Papio anubis (olive baboon)
  • Mass:4286.1 Da
  • Sequence Length:40 aa
  • Isoelectric Point:9.52
  • Activity:Antibacterial, Antifungal, Antiviral
  • Sequence
        IRNPVTCIRSGAICYPRSCPGSYKQIGVCGVSVIKCCKKP
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002564    From 1 To 40 E-value: 3e-17 Score: 79
        IRNPVTCIRSGAICYPRSCPGSYKQIGVCGVSVIKCCKKP
  • 2. L03A000187    From 25 To 64 E-value: 0.0000000000003 Score: 65.9
        IRNPVTCLRSGAICHPGFCPRRYKHIGVCGVSAIKCCKKP
  • 3. L03A000188    From 25 To 64 E-value: 0.0000000000006 Score: 64.7
        IRNPVTCVRSGAICLPGFCPRRYKHIGVCGVSAIKCCKKP
  • 4. L01A002479    From 1 To 36 E-value: 0.00000000002 Score: 59.7
        NPVTCIRSGAICHPGFCPGRYKHIGVCGVPLIKCCK
  • 5. L03A000300    From 25 To 64 E-value: 0.00000000003 Score: 58.9
        IRNPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCRKP

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: