Record in detail


General Info

  • lamp_id:L01A002570
  • Name:sperm-associated antigen 11 variant E
  • FullName:sperm-associated antigen 11 variant E
  • Source:Canis lupus familiaris (dog )
  • Mass:4145.8 Da
  • Sequence Length:35 aa
  • Isoelectric Point:7.78
  • Activity:Antimicrobial
  • Sequence
        RDVICLTQHGTCRLFFCHFGERKAEICSDPWNRCC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002570    From 1 To 35 E-value: 2e-16 Score: 75.9
        RDVICLTQHGTCRLFFCHFGERKAEICSDPWNRCC
  • 2. L01A002488    From 1 To 35 E-value: 0.00000000000001 Score: 70.1
        RDVICLMQHGTCRLFFCHSGEKKSEICSDPWNRCC
  • 3. L12A08375|    From 26 To 60 E-value: 0.0000000000001 Score: 67
        RNIICLMQHGTCRLFFCRSGEKKSEICSDPWNRCC
  • 4. L01A000037    From 1 To 35 E-value: 0.0000000000003 Score: 65.5
        RNIICLMQHGTCRLFFCRSGEKKSEICSDPWNRCC
  • 5. L01A000195    From 8 To 42 E-value: 0.000000000001 Score: 63.9
        RNTICLMQQGTCRLFFCHSGEKKRDICSDPWNRCC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: