Record in detail


General Info

  • lamp_id:L01A002571
  • Name:Beta-defensin 1
  • FullName:Beta-defensin 1
  • Source:Canis lupus familiaris (dog )
  • Mass:3877.5 Da
  • Sequence Length:35 aa
  • Isoelectric Point:8.62
  • Activity:Antimicrobial
  • Sequence
        DQYICARKGGTCNFSPCPLFTRIDGTCYRGKAKCC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF310    From 33 To 67 E-value: 2e-16 Score: 75.9
        DQYICARKGGTCNFSPCPLFTRIDGTCYRGKAKCC
  • 2. L01A002571    From 1 To 35 E-value: 8e-16 Score: 73.9
        DQYICARKGGTCNFSPCPLFTRIDGTCYRGKAKCC
  • 3. L01A002561    From 1 To 35 E-value: 0.0000000000001 Score: 67
        DHYICAKKGGTCNFSPCPLFNRIEGTCYSGKAKCC
  • 4. L01A002547    From 1 To 35 E-value: 0.0000000000001 Score: 67
        DSYICARKGGTCNLSPCPLYNRIEGTCYRGKAKCC
  • 5. L02A001590    From 1 To 35 E-value: 0.0000000000001 Score: 67
        DHYICAKKGGTCNFSPCPLFNRIEGTCYSGKAKCC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: