Record in detail


General Info

  • lamp_id:L01A002573
  • Name:Tracheal antimicrobial peptide
  • FullName:Tracheal antimicrobial peptide
  • Source:Bubalus bubalis ( water buffalo )
  • Mass:3859.6 Da
  • Sequence Length:36 aa
  • Isoelectric Point:10.51
  • Activity:Antimicrobial
  • Sequence
        NPVSCVRNKAICVPIRSPANMKQIGSCVGRAVKCCR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002573    From 1 To 36 E-value: 0.000000000000005 Score: 71.6
        NPVSCVRNKAICVPIRSPANMKQIGSCVGRAVKCCR
  • 2. L01A000349    From 1 To 36 E-value: 0.0000000000003 Score: 65.5
        NPVSCVRNKGICVPIRCPGNMKQIGTCVGRAVKCCR
  • 3. L01A000483    From 1 To 36 E-value: 0.0000000000003 Score: 65.5
        NPVSCVRNKGICVPIRCPGNMKQIGTCVGRAVKCCR
  • 4. L01A001447    From 27 To 62 E-value: 0.0000000000005 Score: 64.7
        NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCR
  • 5. L01A000147    From 1 To 36 E-value: 0.000000000001 Score: 63.9
        NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: