Record in detail


General Info

  • lamp_id:L01A002575
  • Name:palustrin-OG1 antimicrobial peptide
  • FullName:palustrin-OG1 antimicrobial peptide
  • Source:Odorrana grahami (Yunnanfu frog )
  • Mass:3467.1 Da
  • Sequence Length:31 aa
  • Isoelectric Point:10.62
  • Activity:Antimicrobial
  • Sequence
        GLWDTIKQAGKKFFLNVLDKIRCKVAGGCRT
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07262|    From 42 To 72 E-value: 0.0000000000001 Score: 67
        GLWDTIKQAGKKFFLNVLDKIRCKVAGGCRT
  • 2. L12A08454|    From 42 To 72 E-value: 0.0000000000001 Score: 67
        GLWDTIKQAGKKFFLNVLDKIRCKVAGGCRT
  • 3. L12A07261|    From 42 To 72 E-value: 0.0000000000001 Score: 67
        GLWDTIKQAGKKFFLNVLDKIRCKVAGGCRT
  • 4. L12A07032|    From 42 To 72 E-value: 0.0000000000001 Score: 67
        GLWDTIKQAGKKFFLNVLDKIRCKVAGGCRT
  • 5. L12A07031|    From 42 To 72 E-value: 0.0000000000001 Score: 67
        GLWDTIKQAGKKFFLNVLDKIRCKVAGGCRT

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: