Record in detail


General Info

  • lamp_id:L01A002577
  • Name:[27806725]cathelicidin antimicrobial peptide [Bos taurus]
  • FullName:[27806725]cathelicidin antimicrobial peptide [Bos taurus]
  • Source:Bos taurus (cattle)
  • Mass:7612.4 Da
  • Sequence Length:67 aa
  • Isoelectric Point:5.08
  • Activity:Antimicrobial
  • Sequence
        ALSYREAVLRAVDRINERSSEANLYRLLELDPPPKDVEDRGARKPTSFTVKETVCPRTSPQPPEQCD
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002577    From 1 To 67 E-value: 3e-34 Score: 135
        ALSYREAVLRAVDRINERSSEANLYRLLELDPPPKDVEDRGARKPTSFTVKETVCPRTSPQPPEQCD
  • 2. L01A002636    From 18 To 84 E-value: 2e-30 Score: 122
        ALSYREAVLRAVDRINDGSSEANLYRLLELDPPPKDVEDRGARKPASFRVKETVCPRTSQQPLEQCD
  • 3. L01A003872    From 1 To 67 E-value: 3e-30 Score: 121
        ALSYREAVLRAVDRINDGSSEANLYRLLELDPPPKDVEDRGARKPASFRVKETVCPRTSQQPLEQCD
  • 4. L12A10876|    From 20 To 87 E-value: 2e-27 Score: 112
        SFSYREAVLRAVDQFNERSAEANLYRLLELDPPPEQDAEDRGARKPVSFKVKETVCPRTSQQPVEQCD
  • 5. L01A002889    From 1 To 66 E-value: 4e-27 Score: 111
        SYREAVLRAVDQFNERSAEANLYRLLELDPPPEQDAEDRGARKPVSFKVKETVCPRTSQQPVEQCD

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: