Record in detail


General Info

  • lamp_id:L01A002603
  • Name:cecropin A
  • FullName:cecropin A
  • Source:Pseudoplusia includens (soybean looper )
  • Mass:6769.1 Da
  • Sequence Length:62 aa
  • Isoelectric Point:11.01
  • Activity:Antimicrobial
  • Sequence
        MNFKKILFFVFACLVFTVTAAPEPRWKFFKKIEKVGQNIRDGIIKAGPAVAVVGQAAAISGK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002603    From 1 To 62 E-value: 1e-30 Score: 123
        MNFKKILFFVFACLVFTVTAAPEPRWKFFKKIEKVGQNIRDGIIKAGPAVAVVGQAAAISGK
  • 2. L03A000235    From 1 To 62 E-value: 1e-27 Score: 112
        MNLVKILFCVFACLVFTVTAVPEPRWKFFKKIEKVGQNIRDGIIKAGPAVAVVGQAASITGK
  • 3. L03A000216    From 1 To 61 E-value: 3e-22 Score: 95.5
        MNFSRILFFVFACFVALASVSAAPEPRWKVFKKIEKVGRNIRDGVIKAGPAIAVVGQAKAL
  • 4. L03A000212    From 1 To 62 E-value: 4e-22 Score: 95.1
        MNFSRIFFFVFACLTALAMVNAAPEPKWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIA
  • 5. L12A08749|    From 1 To 61 E-value: 9e-22 Score: 94
        MNFSRVLLFVFACLVAACSVSAAPEPRWKVFKKIEKVGRNIRDGVIKAGPAIEVLGQAKAI

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: