Record in detail


General Info

  • lamp_id:L01A002610
  • Name:Neutrophil beta-defensin 4
  • FullName:Neutrophil beta-defensin 4
  • Source:Bubalus bubalis ( water buffalo )
  • Mass:3929.7 Da
  • Sequence Length:36 aa
  • Isoelectric Point:10.51
  • Activity:Antimicrobial
  • Sequence
        SPLSCRGNRGVCLPIRCPGRLRQIGTCFGPRVPCCR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002610    From 1 To 36 E-value: 0.00000000000001 Score: 70.5
        SPLSCRGNRGVCLPIRCPGRLRQIGTCFGPRVPCCR
  • 2. L12A09074|    From 27 To 62 E-value: 0.000000000002 Score: 62.4
        NPLSCRRNKGICLPIRCPGSMRQIGTCFGPRVKCCR
  • 3. L12A02358|    From 7 To 42 E-value: 0.00000000001 Score: 60.5
        NPLSCSRNKGICLPIRCPGSMRQIGTCFGPRVKCCR
  • 4. L03A000267    From 27 To 62 E-value: 0.00000000001 Score: 60.5
        NPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCR
  • 5. L02A000040    From 5 To 40 E-value: 0.00000000002 Score: 60.1
        NPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: