Record in detail


General Info

  • lamp_id:L01A002611
  • Name:DFB39_MOUSE
  • FullName:Beta-defensin 39
  • Source:Mus musculus
  • Mass:6089 Da
  • Sequence Length:51 aa
  • Isoelectric Point:9.14
  • Activity:Antimicrobial
  • Sequence
        DDSIQCFQKNNTCHTNQCPYFQDEIGTCYDKRGKCCQKRLLHIRVPRKKKV
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF191    From 24 To 74 E-value: 2e-26 Score: 109
        DDSIQCFQKNNTCHTNQCPYFQDEIGTCYDKRGKCCQKRLLHIRVPRKKKV
  • 2. L01A002611    From 1 To 51 E-value: 1e-25 Score: 107
        DDSIQCFQKNNTCHTNQCPYFQDEIGTCYDKRGKCCQKRLLHIRVPRKKKV
  • 3. L01A003607    From 2 To 49 E-value: 5e-20 Score: 87.8
        DSVKCFQKNNTCHTIRCPYFQDEVGTCYEGRGKCCQKRLLSIRVPKKK
  • 4. L01A002457    From 1 To 36 E-value: 1e-16 Score: 76.6
        DSIQCFQKNNTCHTNQCPYFQDEIGTCYDRRGKCCQ
  • 5. L03A000152    From 25 To 62 E-value: 0.000000001 Score: 53.1
        DTIKCLQGNNNCHIQKCPWFLLQVSTCYKGKGRCCQKR

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Marquez G.,Martinez-A C.,Albar J.P.,Villares R.,Zaballos A.,
  •   Title:Identification on mouse chromosome 8 of new beta-defensin genes with regionally specific expression in the male reproductive organ.
  •   Journal:J. Biol. Chem., 2004, 279, 12421-12426  [PubMed:14718547]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: