Record in detail


General Info

  • lamp_id:L01A002622
  • Name:D105A_HUMAN
  • FullName:Beta-defensin 105
  • Source:Homo sapiens
  • Mass:5783.6 Da
  • Sequence Length:51 aa
  • Isoelectric Point:8.03
  • Activity:Antimicrobial
  • Sequence
        GLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQRI
  • Function:Has antibacterial activity (Potential).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05A00DEF6    From 28 To 78 E-value: 3e-25 Score: 105
        GLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQRI
  • 2. L12A06323|    From 28 To 78 E-value: 4e-25 Score: 105
        GLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQRI
  • 3. L12A06308|    From 28 To 78 E-value: 7e-25 Score: 103
        GLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRERI
  • 4. L05ADEF202    From 2 To 52 E-value: 1e-24 Score: 103
        GLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQRI
  • 5. L01A002622    From 1 To 51 E-value: 1e-24 Score: 103
        GLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQRI

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Tomita T.,Fukuhara S.,Makita R.,Nagase T.,Yamaguchi Y.,
  •   Title:Identification of multiple novel epididymis-specific beta-defensin isoforms in humans and mice.
  •   Journal:J. Immunol., 2002, 169, 2516-2523  [MEDLINE:22181517]
  •   [2]  Dorin J.R.,Rolfe M.,Semple C.A.M.,
  •   Title:Duplication and selection in the evolution of primate beta-defensin genes.
  •   Journal:Genome Biol., 2003, 4, 0-0  [MEDLINE:22619651]
  •   [3]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: