Record in detail


General Info

  • lamp_id:L01A002640
  • Name:antibacterial protein
  • FullName:antibacterial protein
  • Source:Staphylococcus aureus subsp. aureus COL
  • Mass:4456.1 Da
  • Sequence Length:44 aa
  • Isoelectric Point:5.52
  • Activity:Antimicrobial
  • Sequence
        MTGLAEAIANTVQAAQQHDSVKLGTSIVDIVANGVGLLGKLFGF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002640    From 1 To 44 E-value: 1e-19 Score: 87
        MTGLAEAIANTVQAAQQHDSVKLGTSIVDIVANGVGLLGKLFGF
  • 2. L01A003764    From 1 To 44 E-value: 0.00000000003 Score: 58.9
        MSKLVQAISDAVQAGQNQDWAKLGTSIVGIVENGVGILGKLFGF
  • 3. L01A003768    From 1 To 44 E-value: 0.00000000004 Score: 58.5
        MSKLVQAISDAVQAQQNQDWAKLGTSIVGIVENGVGILGKLFGF
  • 4. L01A002639    From 1 To 44 E-value: 0.00000000004 Score: 58.5
        MEGLFNAIKDTVTAAINNDGAKLGTSIVSIVENGVGLLGKLFGF
  • 5. L01A003763    From 1 To 44 E-value: 0.00000001 Score: 50.4
        MEKIANAVKSAIEAGQNQDWTKLGTSILDIVSNGVTELSKIFGF

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: