Record in detail


General Info

  • lamp_id:L01A002652
  • Name:milk lysozyme
  • FullName:milk lysozyme
  • Source:Bos indicus x Bos taurus (hybrid cattle)
  • Mass:5041.1 Da
  • Sequence Length:45 aa
  • Isoelectric Point:11.02
  • Activity:Antimicrobial
  • Sequence
        MKALLILGLLLFSVAVQGKVFERCELARSLKRFGMDNFRGITLAN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002652    From 1 To 45 E-value: 2e-20 Score: 89.7
        MKALLILGLLLFSVAVQGKVFERCELARSLKRFGMDNFRGITLAN
  • 2. L01A002651    From 1 To 45 E-value: 0.000000000000001 Score: 73.6
        MKALLILGLLLFSVAVQGKVFERCELARSLKRFGMDNFRGISLAN
  • 3. L12A05430|    From 1 To 27 E-value: 0.0000007 Score: 44.3
        KVFERXELARTLKRLGLDGFRGVSLPN
  • 4. L12A05084|    From 1 To 20 E-value: 0.022 Score: 29.3
        KIFTKCELARKLRAEGMDGF
  • 5. L12A11088|    From 4 To 27 E-value: 0.21 Score: 26.2
        KKCEFAKIAKEQHMDGYHGVSLAD

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: