Record in detail


General Info

  • lamp_id:L01A002657
  • Name:antibacterial peptide
  • FullName:antibacterial peptide
  • Source:Rana chensinensis (Chinese brown frog )
  • Mass:6872.9 Da
  • Sequence Length:60 aa
  • Isoelectric Point:4.55
  • Activity:Antimicrobial
  • Sequence
        MFTLKKSLLLLFFLGTINLSLCEEERNADEERRDDPEERAVEVEKRILPILSLIGGLLGK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002657    From 1 To 60 E-value: 1e-28 Score: 116
        MFTLKKSLLLLFFLGTINLSLCEEERNADEERRDDPEERAVEVEKRILPILSLIGGLLGK
  • 2. L01A003834    From 1 To 53 E-value: 3e-19 Score: 85.9
        MFTFKKSMLLLFFLGTINLSLCEQERNADEEERRDDPDETNVEVEKRFLPLLA
  • 3. L12A07168|    From 1 To 53 E-value: 3e-18 Score: 82
        MFTLKKSMLLLFFLGTINLSLCEQERNADEEERRDNPDEMDVVVEKRFLPLLA
  • 4. L12A07345|    From 1 To 47 E-value: 7e-17 Score: 77.8
        MFTMKKSMLLLFFLGTINLSLCEQERDAEEERRDDEDKRDVEVEKRF
  • 5. L12A07365|    From 1 To 59 E-value: 2e-16 Score: 76.3
        MFTTKKPMLLLFFLGTINFSLCEQERDAEEERRDDQDKRDVEVEKRFFLPLLGAAAQVL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: