Record in detail


General Info

  • lamp_id:L01A002661
  • Name:DEFN_HELVI
  • FullName:Defensin heliomicin
  • Source:Heliothis virescens
  • Mass:4790.3 Da
  • Sequence Length:44 aa
  • Isoelectric Point:7.76
  • Activity:Antifungal
  • Sequence
        DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET
  • Function:This peptide has potent anti-fungal activity. Has no activity against Gram-negative and Gram-positive bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002661    From 1 To 44 E-value: 4e-21 Score: 92
        DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET
  • 2. L11A004599    From 1 To 44 E-value: 1e-20 Score: 90.1
        DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCRT
  • 3. L13A018520    From 1 To 44 E-value: 1e-20 Score: 89.7
        DKLIGSCVWGAVNYTSDCNGECKRRGYKGGYCGSFANVNCWCET
  • 4. L01A000663    From 1 To 44 E-value: 3e-20 Score: 89
        DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFANVNCWCET
  • 5. L11A004597    From 1 To 44 E-value: 4e-20 Score: 88.6
        DKLIGSCVWGAVNYTSDCAAECKRRGYKGGHCGSFANVNCWCET

Structure

  •   Domains
  •   1  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   2  Name:Scorpion_toxinL/defesin    Interpro Link:IPR002061
  •   Structures

Activity

  •   Antibacterial Activities
  •   1  Target:  N. crassa  MIC:  0.48 μg/ml  (0.100202 μM)  
  •   2  Target:  F. culmorum  MIC:  0.96 μg/ml  (0.200405 μM)  
  •   3  Target:  F. oxysporum  MIC:  7.19 μg/ml  (1.50095 μM)  
  •   4  Target:  N. haematococca  MIC:  1.92 μg/ml  (0.40081 μM)  
  •   5  Target:  A. fumigatus  MIC:  28.74 μg/ml  (5.99962 μM)  
  •   6  Target:  T. viride  MIC:  7.19 μg/ml  (1.50095 μM)  
  •   7  Target:  C. albicans  MIC:  11.98 μg/ml  (2.50089 μM)  
  •   8  Target:  C. neoformans  MIC:  11.98 μg/ml  (2.50089 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Bushey D.,Brookhart G.,Uttenweiler-Joseph S.,Ades S.,Lamberty M.,
  •   Title:Insect immunity. Isolation from the lepidopteran Heliothis virescens of a novel insect defensin with potent antifungal activity.
  •   Journal:J. Biol. Chem., 1999, 274, 9320-9326  [MEDLINE:99194775]
  •   [2]  Hetru C.,Tassin-Moindrot S.,Landon C.,Caille A.,Lamberty M.,
  •   Title:Solution structures of the antifungal heliomicin and a selected variant with both antibacterial and antifungal activities.
  •   Journal:Biochemistry, 2001, 40, 11995-12003  [MEDLINE:21464431]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: