Record in detail


General Info

  • lamp_id:L01A002662
  • Name:Heliomicin Mutant
  • FullName:Heliomicin Mutant
  • Source:Heliothis virescens (tobacco budworm)
  • Mass:4732.3 Da
  • Sequence Length:44 aa
  • Isoelectric Point:5.59
  • Activity:Antibacterial, Antifungal
  • Sequence
        DKLIGSCVWGAVNYTSDCNGECLLRGYKGGHCGSFANVNCWCET
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002662    From 1 To 44 E-value: 4e-21 Score: 91.7
        DKLIGSCVWGAVNYTSDCNGECLLRGYKGGHCGSFANVNCWCET
  • 2. L11A004604    From 1 To 44 E-value: 1e-20 Score: 90.1
        DKLIGSCVWGAVNYTSDCNGECLLRGYKGGHCGSFANVNCWCRT
  • 3. L11A004605    From 1 To 44 E-value: 5e-20 Score: 88.2
        DKLIGSCVWGAVNYTSDCAAECLLRGYKGGHCGSFANVNCWCET
  • 4. L01A002661    From 1 To 44 E-value: 8e-20 Score: 87.4
        DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET
  • 5. L11A004609    From 1 To 44 E-value: 1e-19 Score: 86.7
        DKLIGSCVWGAVNYTSDCAAECLLRGYKGGHCGSFANVNCWCRT

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: