Record in detail


General Info

  • lamp_id:L01A002670
  • Name:PEN4D_LITSE
  • FullName:Penaeidin-4d
  • Source:Litopenaeus setiferus
  • Mass:5304.1 Da
  • Sequence Length:47 aa
  • Isoelectric Point:8.86
  • Activity:Antibacterial, Antifungal
  • Sequence
        HSSGYTRPLRKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHL
  • Function:Antibacterial and antifungal activity. Presents chitin-binding activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09100|    From 20 To 66 E-value: 5e-23 Score: 98.2
        HSSGYTRPLRKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHL
  • 2. L01A002670    From 1 To 47 E-value: 1e-22 Score: 96.7
        HSSGYTRPLRKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHL
  • 3. L12A09151|    From 20 To 66 E-value: 4e-22 Score: 95.1
        HSSGYTRPLPKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHL
  • 4. L13A025036    From 1 To 46 E-value: 5e-22 Score: 94.7
        HSSGYTRPLRKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCH
  • 5. L12A09125|    From 20 To 65 E-value: 1e-21 Score: 93.2
        HSSGYTRPLPKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCH

Structure

  •   Domains
  •   1  Name:Penaeidin    Interpro Link:IPR009226
  •   Structures

Activity

  •   Antibacterial Activities
  •   1  Target:  Fusarium oxysporum  MIC:  4.46 μg/ml  (0.840859 μM)  
  •   2  Target:  Botrytis cinerea  MIC:  23.23 μg/ml  (4.37963 μM)  
  •   3  Target:  Penicillium crustosum  MIC:  6.68 μg/ml  (1.2594 μM)  
  •   4  Target:  Aerococcus viridans  MIC:  10.08 μg/ml  (1.90042 μM)  
  •   5  Target:  Bacillus megaterium  MIC:  265.21 μg/ml  (50.0009 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Gross P.S.,Chapman R.W.,Shepard E.F.,Cuthbertson B.J.,
  •   Title:Diversity of the penaeidin antimicrobial peptides in two shrimp species.
  •   Journal:Immunogenetics, 2002, 54, 442-445  [MEDLINE:22226701]
  •   [2]  Gross P.S.,Bullesbach E.E.,Bachere E.,Yang Y.,Cuthbertson B.J.,
  •   Title:Solution structure of synthetic penaeidin-4 with structural and functional comparisons with penaeidin-3.
  •   Journal:J. Biol. Chem., 2005, 280, 16009-16018  [PubMed:15699044]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: