Record in detail


General Info

  • lamp_id:L01A002686
  • Name:ixosin - B
  • FullName:ixosin - B
  • Source:Ixodes sinensis
  • Mass:3814.2 Da
  • Sequence Length:32 aa
  • Isoelectric Point:11.45
  • Activity:Antibacterial, Antifungal
  • Sequence
        QLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06428|    From 58 To 89 E-value: 0.00000000000001 Score: 70.1
        QLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY
  • 2. L01A002686    From 1 To 32 E-value: 0.0000000000001 Score: 67
        QLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY
  • 3. L11A004579    From 1 To 13 E-value: 0.02 Score: 29.6
        QLKVDLWGTRSGI
  • 4. L11A004580    From 1 To 12 E-value: 0.082 Score: 27.7
        QHSSGKSDVRRW
  • 5. L11A004561    From 1 To 12 E-value: 0.11 Score: 27.3
        GKSDVRRWRSRY

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: