Record in detail
General Info
- lamp_id:L01A002687
- Name:AMP_AMARE
- FullName:Antimicrobial peptide Ar-AMP
- Source:Amaranthus retroflexus
- Mass:3161.6 Da
- Sequence Length:30 aa
- Isoelectric Point:8.38
- Activity:Antifungal
- Sequence
AGECVQGRCPSGMCCSQFGYCGRGPKYCGR - Function:Chitin-binding protein that inhibits the growth of the fungal pathogens B.cinerea, F.culmorum, H.sativum and A.consortiale, but not that of R.solani. Induces morphological changes in the fungal pathogens F.culmorum, H.sativum and R.solani, but not in A.consortiale and B.cinerea. Has antibacterial activity against the Gram-positive bacterium B.subtilis, but lacks antibacterial activity against the Gram-negative bacterium E.coli.
Cross-Linking
- Cross-linking
- 1 Database:APD 912
- 2 Database:CAMP CAMPSQ743
- 3 Database:DBAASP 3163
- 4 Database:dbAMP dbAMP_00200
- 5 Database:DRAMP DRAMP00984
- 6 Database:SATPdb satpdb27755
- 7 Database:Uniprot Q5I2B2
- 8 Database:PHY PHYT00224
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A09584| From 26 To 55 E-value: 0.0000000000001 Score: 67
AGECVQGRCPSGMCCSQFGYCGRGPKYCGR - 2. L03A000310 From 26 To 55 E-value: 0.000000000004 Score: 62
VGECVRGRCPSGMCCSQFGYCGKGPKYCGR - 3. L01A002687 From 1 To 30 E-value: 0.000000000007 Score: 61.2
AGECVQGRCPSGMCCSQFGYCGRGPKYCGR - 4. L01A000210 From 1 To 30 E-value: 0.0000000001 Score: 57.4
VGECVRGRCPSGMCCSQFGYCGKGPKYCGR - 5. L12A11744| From 1 To 30 E-value: 0.0000000002 Score: 56.2
VGECVRGRCPSGMCCSQFGFCGKGPKYCGR
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Krause E.,Babakov A.,Nikonorova A.,Anisimova V.,Lipkin A.,
- Title:An antimicrobial peptide Ar-AMP from amaranth (Amaranthus retroflexus L.) seeds.
- Journal:Phytochemistry, 2005, 66, 2426-2431 [PubMed:16126239]
Comments
- Comments
No comments found on LAMP database