Record in detail


General Info

  • lamp_id:L01A002687
  • Name:AMP_AMARE
  • FullName:Antimicrobial peptide Ar-AMP
  • Source:Amaranthus retroflexus
  • Mass:3161.6 Da
  • Sequence Length:30 aa
  • Isoelectric Point:8.38
  • Activity:Antifungal
  • Sequence
        AGECVQGRCPSGMCCSQFGYCGRGPKYCGR
  • Function:Chitin-binding protein that inhibits the growth of the fungal pathogens B.cinerea, F.culmorum, H.sativum and A.consortiale, but not that of R.solani. Induces morphological changes in the fungal pathogens F.culmorum, H.sativum and R.solani, but not in A.consortiale and B.cinerea. Has antibacterial activity against the Gram-positive bacterium B.subtilis, but lacks antibacterial activity against the Gram-negative bacterium E.coli.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09584|    From 26 To 55 E-value: 0.0000000000001 Score: 67
        AGECVQGRCPSGMCCSQFGYCGRGPKYCGR
  • 2. L03A000310    From 26 To 55 E-value: 0.000000000004 Score: 62
        VGECVRGRCPSGMCCSQFGYCGKGPKYCGR
  • 3. L01A002687    From 1 To 30 E-value: 0.000000000007 Score: 61.2
        AGECVQGRCPSGMCCSQFGYCGRGPKYCGR
  • 4. L01A000210    From 1 To 30 E-value: 0.0000000001 Score: 57.4
        VGECVRGRCPSGMCCSQFGYCGKGPKYCGR
  • 5. L12A11744|    From 1 To 30 E-value: 0.0000000002 Score: 56.2
        VGECVRGRCPSGMCCSQFGFCGKGPKYCGR

Structure

  •   Domains
  •   1  Name:Antimicrobial_C6_CS    Interpro Link:IPR013006
  •   2  Name:Chitin-bd_1    Interpro Link:IPR001002
  •   3  Name:Chitin-binding_1_CS    Interpro Link:IPR018371
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Krause E.,Babakov A.,Nikonorova A.,Anisimova V.,Lipkin A.,
  •   Title:An antimicrobial peptide Ar-AMP from amaranth (Amaranthus retroflexus L.) seeds.
  •   Journal:Phytochemistry, 2005, 66, 2426-2431  [PubMed:16126239]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: