Record in detail


General Info

  • lamp_id:L01A002690
  • Name:SNAK2_SOLTU
  • FullName:Snakin-2
  • Source:Solanum tuberosum
  • Mass:7037 Da
  • Sequence Length:66 aa
  • Isoelectric Point:8.83
  • Activity:Antibacterial, Antifungal
  • Sequence
        YSYKKIDCGGACAARCRLSSRPRLCNRACGTCCARCNCVPPGTSGNTETCPCYASLTTHGNKRKCP
  • Function:Has an antimicrobial activity. Causes a rapid aggregation of both Gram-positive and Gram-negative bacteria, but the antimicrobial activity is not correlated with the capacity to aggregate bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002690    From 1 To 66 E-value: 1e-32 Score: 129
        YSYKKIDCGGACAARCRLSSRPRLCNRACGTCCARCNCVPPGTSGNTETCPCYASLTTHGNKRKCP
  • 2. L12A01216|    From 2 To 66 E-value: 2e-31 Score: 125
        SYKKIDCGGACAARCRLSSRPRLCHRACGTCCARCNCVPPGTSGNTETCPCYASLTTHGNKRKCP
  • 3. L12A11355|    From 1 To 65 E-value: 2e-31 Score: 125
        SYKKIDCGGACAARCRLSSRPRLCHRACGTCCARCNCVPPGTSGNTETCPCYASLTTHGNKRKCP
  • 4. L01A000889    From 36 To 99 E-value: 2e-27 Score: 112
        LQQIDCNGACAARCRLSSRPRLCQRACGTCCRRCNCVPPGTAGNQEVCPCYASLTTHGGKRKCP
  • 5. L01A000866    From 13 To 75 E-value: 2e-26 Score: 108
        KKIDCGGACAARCQLSSRPHLCKRACGTCCARSRCVPPGTAGNQEMCPCYASLTTHGGKRKCP

Structure

  •   Domains
  •   1  Name:GASA    Interpro Link:IPR003854
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Clavibacter michiganensis  EC:  7.04 μg/ml  (1.00043 μM)  
  •   2  Target:  R. solanacearum rfa-  EC:  211.11 μg/ml  (30 μM)  
  •   3  Target:  Rhizobium meliloti  EC:  56.3 μg/ml  (8.00057 μM)  
  •   4  Target:  Botrytis cinerea  EC:  14.07 μg/ml  (1.99943 μM)  
  •   5  Target:  Fusarium solani  EC:  14.07 μg/ml  (1.99943 μM)  
  •   6  Target:  Fusarium culmorum  EC:  14.07 μg/ml  (1.99943 μM)  
  •   7  Target:  Fusarium oxysporum f. sp. conglutinans  EC:  70.37 μg/ml  (10 μM)  
  •   8  Target:  Fusarium oxysporum f. sp. lycopersici  EC:  140.74 μg/ml  (20 μM)  
  •   9  Target:  Plectosphaerella cucumerina  EC:  70.37 μg/ml  (10 μM)  
  •   10  Target:  Colletotrichum graminicola  EC:  70.37 μg/ml  (10 μM)  
  •   11  Target:  Colletotrichum lagenarium  EC:  70.37 μg/ml  (10 μM)  
  •   12  Target:  Bipolaris maydis  EC:  140.74 μg/ml  (20 μM)  
  •   13  Target:  Aspergillus flavus  EC:  140.74 μg/ml  (20 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Garcia-Olmedo F.,Lopez G.,Moreno M.,Segura A.,Berrocal-Lobo M.,
  •   Title:Snakin-2, an antimicrobial peptide from potato whose gene is locally induced by wounding and responds to pathogen infection.
  •   Journal:Plant Physiol., 2002, 128, 951-961  [PubMed:11891250]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: