Record in detail


General Info

  • lamp_id:L01A002691
  • Name:PERI_PERAI
  • FullName:Perinerin
  • Source:Perinereis aibuhitensis
  • Mass:5977.9 Da
  • Sequence Length:51 aa
  • Isoelectric Point:11.31
  • Activity:Antibacterial, Antifungal
  • Sequence
        FNKLKQGSSKRTCAKCFRKIMPSVHELDERRRGANRWAAGFRKCVSSICRY
  • Function:Antibacterial activity against both Gram-negative and Gram-positive bacteria. Shows marked activity against P.aeruginosa, B.megaterium, A.viridans, moderate activity against E.coli K-12, S.aureus and M.luteus, and minor activity against P.vulgaris. Antifungal activity against P.heliothis.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002691    From 1 To 51 E-value: 1e-25 Score: 106
        FNKLKQGSSKRTCAKCFRKIMPSVHELDERRRGANRWAAGFRKCVSSICRY
  • 2. L13A026985    From 1 To 50 E-value: 9e-25 Score: 103
        FNKLKQGSSKRTCAKCFRKIMPSVHELDERRRGANRWAAGFRKCVSSICR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zheng T.,Han J.,Ge F.,Liu X.-H.,Pan W.-D.,
  •   Title:Perinerin, a novel antimicrobial peptide purified from the clamworm Perinereis aibuhitensis Grube and its partial characterization.
  •   Journal:J. Biochem., 2004, 135, 297-304  [PubMed:15113828]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: