Record in detail


General Info

  • lamp_id:L01A002701
  • Name:CYO2_VIOOD
  • FullName:Cycloviolacin-O2
  • Source:Viola odorata
  • Mass:3164.7 Da
  • Sequence Length:30 aa
  • Isoelectric Point:8.11
  • Activity:Antimicrobial, ,Anticancer
  • Sequence
        GIPCGESCVWIPCISSAIGCSCKSKVCYRN
  • Function:Probably participates in a plant defense mechanism. Has strong cytotoxic activity against a variety of drug-resistant and drug-sensitive human tumor cell lines, and against primary chronic lymphocytic leukemia and ovarian carcinoma cells. Has weaker cytotoxic activity against normal lymphocytes. Has hemolytic activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002701    From 1 To 30 E-value: 0.000000000008 Score: 60.8
        GIPCGESCVWIPCISSAIGCSCKSKVCYRN
  • 2. L02A001144    From 1 To 30 E-value: 0.00000000001 Score: 60.5
        GIPCGESCVWIPCITSAIGCSCKSKVCYRN
  • 3. L02A001064    From 1 To 30 E-value: 0.00000000001 Score: 60.1
        GIPCGESCVWIPCISAAIGCSCKSKVCYRN
  • 4. L06AT00179    From 1 To 30 E-value: 0.00000000002 Score: 59.7
        GIPCGESCVWIPCISSAIGCSCKNKVCYRN
  • 5. L06AT00178    From 1 To 30 E-value: 0.00000000002 Score: 59.7
        GIPCGESCVWIPCLTSAIGCSCKSKVCYRN

Structure

  •   Domains
  •   1  Name:Cyclotide    Interpro Link:IPR005535
  •   2  Name:Cyclotide_bracelet_CS    Interpro Link:IPR012323
  •   3  Name:Cyclotide_subgr    Interpro Link:IPR017307
  •   Structures

Activity

  •   Antibacterial Activities
  •   1  Target:  10 human tumor cell lines  IC50:  0.32 μg/ml  (0.101115 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Waine C.,Bond T.,Daly N.L.,Craik D.J.,
  •   Title:Plant cyclotides: a unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif.
  •   Journal:J. Mol. Biol., 1999, 294, 1327-1336  [MEDLINE:20069951]
  •   [2]  Gullbo J.,Claeson P.,Johansson S.,Goransson U.,Lindholm P.,
  •   Title:Cyclotides: a novel type of cytotoxic agents.
  •   Journal:Mol. Cancer Ther., 2002, 1, 365-369  [PubMed:12477048]
  •   [3]  Craik D.J.,Colgrave M.L.,Ireland D.C.,
  •   Title:A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability.
  •   Journal:Biochem. J., 2006, 400, 1-12  [PubMed:16872274]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: