Record in detail


General Info

  • lamp_id:L01A002702
  • Name:CYVE_VIOBI
  • FullName:Cyclotide vibi-E
  • Source:Viola biflora
  • Mass:3105.6 Da
  • Sequence Length:30 aa
  • Isoelectric Point:5.93
  • Activity:Antimicrobial, ,Anticancer,Anticancer
  • Sequence
        GIPCAESCVWIPCTVTALIGCGCSNKVCYN
  • Function:Probably participates in a plant defense mechanism. Has cytotoxic activity, active against a human lymphoma cell line with an IC(50) of 3.2 uM.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002702    From 1 To 30 E-value: 0.000000000004 Score: 62
        GIPCAESCVWIPCTVTALIGCGCSNKVCYN
  • 2. L02A001143    From 1 To 30 E-value: 0.00000000002 Score: 59.3
        GIPCAESCVWIPCTVTALLGCSCSNKVCYN
  • 3. L12A06260|    From 45 To 74 E-value: 0.00000000003 Score: 58.9
        GIPCAESCVWIPCTITALMGCSCKNNVCYN
  • 4. L01A002727    From 1 To 30 E-value: 0.00000000004 Score: 58.5
        GIPCAESCVWIPCTVTALVGCSCSDKVCYN
  • 5. L06AT00160    From 1 To 30 E-value: 0.00000000008 Score: 57.4
        GIPCAESCVWIPCTVTALLGCSCSNNVCYN

Structure

  •   Domains
  •   1  Name:Cyclotide    Interpro Link:IPR005535
  •   2  Name:Cyclotide_bracelet_CS    Interpro Link:IPR012323
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Human lymphoma cell line  IC50:  9.94 μg/ml  (3.20067 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Gullbo J.,Karlsson G.,Mylne J.S.,Burman R.,Herrmann A.,
  •   Title:The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity.
  •   Journal:Phytochemistry, 2008, 69, 939-952  [PubMed:18191970]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: