Record in detail


General Info

  • lamp_id:L01A002703
  • Name:CYVG_VIOBI
  • FullName:Cyclotide vibi-G
  • Source:Viola biflora
  • Mass:3246.8 Da
  • Sequence Length:31 aa
  • Isoelectric Point:8.11
  • Activity:Antimicrobial, ,Anticancer,Anticancer
  • Sequence
        GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN
  • Function:Probably participates in a plant defense mechanism. Has cytotoxic activity, active against a human lymphoma cell line with an IC(50) of 0.96 uM.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A12205|    From 57 To 87 E-value: 0.0000000000005 Score: 65.1
        GTIPCGESCVFIPCLTSAIGCSCKSKVCYKN
  • 2. L12A11674|    From 59 To 89 E-value: 0.0000000000006 Score: 64.7
        GTIPCGESCVFIPCLTSAIGCSCKSKVCYKN
  • 3. L01A002703    From 1 To 31 E-value: 0.000000000001 Score: 63.5
        GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN
  • 4. L02A001122    From 1 To 31 E-value: 0.000000000008 Score: 60.8
        GTIPCGESCVFIPCLTSALGCSCKSKVCYKN
  • 5. L06AT00181    From 1 To 31 E-value: 0.00000000009 Score: 57.4
        GTLPCGESCVWIPCISAAVGCSCKSKVCYKN

Structure

  •   Domains
  •   1  Name:Cyclotide    Interpro Link:IPR005535
  •   2  Name:Cyclotide_bracelet_CS    Interpro Link:IPR012323
  •   3  Name:Cyclotide_subgr    Interpro Link:IPR017307
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Human lymphoma cell line  IC50:  3.12 μg/ml  (0.960946 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Gullbo J.,Karlsson G.,Mylne J.S.,Burman R.,Herrmann A.,
  •   Title:The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity.
  •   Journal:Phytochemistry, 2008, 69, 939-952  [PubMed:18191970]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: