Record in detail


General Info

  • lamp_id:L01A002704
  • Name:CYVH_VIOBI
  • FullName:Cyclotide vibi-H
  • Source:Viola biflora
  • Mass:3297 Da
  • Sequence Length:31 aa
  • Isoelectric Point:8.11
  • Activity:Antimicrobial, ,Anticancer,Anticancer
  • Sequence
        GLLPCAESCVYIPCLTTVIGCSCKSKVCYKN
  • Function:Probably participates in a plant defense mechanism. Has cytotoxic activity, active against a human lymphoma cell line with an IC(50) of 1.6 uM.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002704    From 1 To 31 E-value: 0.000000000002 Score: 62.8
        GLLPCAESCVYIPCLTTVIGCSCKSKVCYKN
  • 2. L12A12205|    From 57 To 87 E-value: 0.00000000009 Score: 57.4
        GTIPCGESCVFIPCLTSAIGCSCKSKVCYKN
  • 3. L12A11674|    From 59 To 89 E-value: 0.0000000001 Score: 57.4
        GTIPCGESCVFIPCLTSAIGCSCKSKVCYKN
  • 4. L12A05610|    From 61 To 91 E-value: 0.0000000004 Score: 55.1
        GVIPCGESCVFIPCISSVLGCSCKNKVCYRN
  • 5. L01A002703    From 1 To 31 E-value: 0.0000000004 Score: 55.1
        GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN

Structure

  •   Domains
  •   1  Name:Cyclotide    Interpro Link:IPR005535
  •   2  Name:Cyclotide_bracelet_CS    Interpro Link:IPR012323
  •   3  Name:Cyclotide_subgr    Interpro Link:IPR017307
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Human lymphoma cell line  IC50:  5.28 μg/ml  (1.60146 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Gullbo J.,Karlsson G.,Mylne J.S.,Burman R.,Herrmann A.,
  •   Title:The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity.
  •   Journal:Phytochemistry, 2008, 69, 939-952  [PubMed:18191970]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: