Record in detail
General Info
- lamp_id:L01A002712
- Name:DEF6_HUMAN
- FullName:Defensin-6
- Source:Homo sapiens
- Mass:3714.2 Da
- Sequence Length:32 aa
- Isoelectric Point:8.12
- Activity:Antibacterial
- Sequence
AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL - Function:Has very low antimicrobial activity against Gram-negative and Gram-positive bacteria. May protect cells against infection with HIV-1.
Cross-Linking
- Cross-linking
- 1 Database:APD 181
- 2 Database:CAMP CAMPSQ755
- 3 Database:DBAASP 1772
- 4 Database:dbAMP dbAMP_00191
- 5 Database:DRAMP DRAMP03596
- 6 Database:SATPdb satpdb24466
- 7 Database:Uniprot Q01524
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A003418 From 4 To 35 E-value: 0.00000000000009 Score: 67.4
AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL - 2. L01A002712 From 1 To 32 E-value: 0.0000000000001 Score: 67
AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL - 3. L13A011306 From 1 To 31 E-value: 0.0000000000004 Score: 65.1
AFTCHCRRSCYSTEYSYGTCTVMGINHRFCC - 4. L12A00192| From 1 To 32 E-value: 0.0000000000007 Score: 64.3
AFTCHCRRSCYSTEYSYGTCTVMGINWRFCCL - 5. L12A09221| From 63 To 93 E-value: 0.001 Score: 33.9
IICHCRRLLCLSSEHLSGICTIKGVRYPFCC
Structure
Activity
- Antibacterial Activities
- 1 Target: E. faecium ATCC 1438 IC50: 4 μg/ml (1.07695 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Bevins C.L.,Jones D.E.,
- Title:Defensin-6 mRNA in human Paneth cells: implications for antimicrobial peptides in host defense of the human bowel.
- Journal:FEBS Lett., 1993, 315, 187-192 [MEDLINE:93114459]
- [2] Deberardinis R.J.,Russell J.P.,Salzman N.,Harris A.,Mallow E.B.,
- Title:Human enteric defensins. Gene structure and developmental expression.
- Journal:J. Biol. Chem., 1996, 271, 4038-4045 [MEDLINE:96223969]
- [3]
- Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
- Journal:Genome Res., 2004, 14, 2121-2127 [PubMed:15489334]
- [4] Lehrer R.I.,Lu W.,Wu Z.,Ericksen B.,
- Title:Antibacterial activity and specificity of the six human alpha-defensins.
- Journal:Antimicrob. Agents Chemother., 2005, 49, 269-275 [PubMed:15616305]
- [5] Lu W.,Yang D.,Tucker K.,Wu Z.,Szyk A.,
- Title:Crystal structures of human alpha-defensins HNP4, HD5, and HD6.
- Journal:Protein Sci., 2006, 15, 2749-2760 [PubMed:17088326]
Comments
- Comments
No comments found on LAMP database