Record in detail


General Info

  • lamp_id:L01A002719
  • Name:PALIC_PALCO
  • FullName:Palicourein
  • Source:Palicourea condensata
  • Mass:3928.4 Da
  • Sequence Length:37 aa
  • Isoelectric Point:4.6
  • Activity:Antiviral
  • Sequence
        GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN
  • Function:Probably participates in a plant defense mechanism. Inhibits the cytopathic effects of the human immunodeficiency virus.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002719    From 1 To 37 E-value: 1e-16 Score: 77
        GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN
  • 2. L02A001034    From 1 To 34 E-value: 0.00000000000001 Score: 70.5
        TFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN
  • 3. L12A00817|    From 1 To 28 E-value: 0.016 Score: 30
        CGESCVYIP-CTVTALLGCSCKDK---VCYKN
  • 4. L13A019809    From 4 To 31 E-value: 0.017 Score: 29.6
        CGESCVFIP-CTVTALLGCSCKDK---VCYKN
  • 5. L13A012166    From 4 To 31 E-value: 0.021 Score: 29.6
        CGESCVYIP-CTVTALLGCSCKDK---VCYKN

Structure

  •   Domains
  •   1  Name:Cyclotide    Interpro Link:IPR005535
  •   Structures

Activity

  •   Antibacterial Activities
  •   1  Target:  HIV-1RF  IC50:  5.89 μg/ml  (1.49934 μM)  
  •   2  Target:  HIV-1RF  EC:  0.39 μg/ml  (0.0992771 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  McKee T.C.,Sowder R.C. II,Cochran P.K.,Pannell L.K.,Bokesch H.R.,
  •   Title:A novel anti-HIV macrocyclic peptide from Palicourea condensata.
  •   Journal:J. Nat. Prod., 2001, 64, 249-250  [PubMed:11430013]
  •   [2]  Craik D.J.,Gustafson K.R.,Bokesch H.R.,Daly N.L.,Barry D.G.,
  •   Title:Solution structure of the cyclotide palicourein: implications for the development of a pharmaceutical framework.
  •   Journal:Structure, 2004, 12, 85-94  [PubMed:14725768]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: