Record in detail
General Info
- lamp_id:L01A002721
- Name:CIRC_CHAPA
- FullName:Circulin-C
- Source:Chassalia parviflora
- Mass:3125.7 Da
- Sequence Length:30 aa
- Isoelectric Point:8.11
- Activity:Antiviral
- Sequence
CGESCVFIPCITSVAGCSCKSKVCYRNGIP - Function:Probably participates in a plant defense mechanism. Inhibits the cytopathic effects of the human immunodeficiency virus.
Cross-Linking
- Cross-linking
- 1 Database:APD 1060
- 2 Database:CAMP CAMPSQ764
- 3 Database:dbAMP dbAMP_00813
- 4 Database:SATPdb satpdb20019
- 5 Database:Uniprot P84641
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A002721 From 1 To 30 E-value: 0.000000000007 Score: 61.2
CGESCVFIPCITSVAGCSCKSKVCYRNGIP - 2. L02A001044 From 1 To 30 E-value: 0.0000000002 Score: 56.2
CGESCVYIPCLTSAVGCSCKSKVCYRNGIP - 3. L02A001043 From 1 To 30 E-value: 0.0000000002 Score: 56.2
CGESCVWIPCLTSAVGCSCKSKVCYRNGIP - 4. L02A001046 From 1 To 30 E-value: 0.0000000002 Score: 55.8
CGESCVYIPCLTSAIGCSCKSKVCYRNGIP - 5. L02A001809 From 1 To 30 E-value: 0.0000000003 Score: 55.8
CGESCVFIPCISSVIGCSCSSKVCYRNGIP
Activity
- Antibacterial Activities
- 1 Target: HIV-1 EC: 50 μg/ml (15.9964 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Pannell L.K.,Johnson D.G.,Sowder R.C. Jr.,Walton L.K.,Gustafson K.R.,
- Title:New circulin macrocyclic polypeptides from Chassalia parvifolia.
- Journal:J. Nat. Prod., 2000, 63, 176-178 [PubMed:10691702]
Comments
- Comments
No comments found on LAMP database