Record in detail
General Info
- lamp_id:L01A002722
- Name:CIRD_CHAPA
- FullName:Circulin-D
- Source:Chassalia parviflora
- Mass:3420 Da
- Sequence Length:30 aa
- Isoelectric Point:7.03
- Activity:Antiviral
- Sequence
KIPCGESCVWIPCVTSIFNCKCENKVCYHD - Function:Probably participates in a plant defense mechanism. Inhibits the cytopathic effects of the human immunodeficiency virus.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ765
- 2 Database:DBAASP 2983
- 3 Database:dbAMP dbAMP_05099
- 4 Database:SATPdb satpdb28349
- 5 Database:Uniprot P84642
- 6 Database:PHY PHYT00147
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A002722 From 1 To 30 E-value: 0.000000000001 Score: 63.9
KIPCGESCVWIPCVTSIFNCKCENKVCYHD - 2. L01A002723 From 1 To 30 E-value: 0.000000000002 Score: 62.8
KIPCGESCVWIPCLTSVFNCKCENKVCYHD - 3. L13A023334 From 1 To 31 E-value: 0.00000000002 Score: 59.3
KIPCGESCVWIPCVTSIFNCKCKENKVCYHD - 4. L13A022756 From 1 To 31 E-value: 0.00000000002 Score: 59.3
KIPCGESCVWIPCVTSIFNCKCKENKVCYHD - 5. L02A001062 From 1 To 27 E-value: 0.0000000001 Score: 57
CGESCVWIPCLTSVFNCKCENKVCYHD
Activity
- Antibacterial Activities
- 1 Target: HIV-1 EC: 50 μg/ml (14.6199 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Pannell L.K.,Johnson D.G.,Sowder R.C. Jr.,Walton L.K.,Gustafson K.R.,
- Title:New circulin macrocyclic polypeptides from Chassalia parvifolia.
- Journal:J. Nat. Prod., 2000, 63, 176-178 [PubMed:10691702]
Comments
- Comments
No comments found on LAMP database