Record in detail


General Info

  • lamp_id:L01A002737
  • Name:CAMP_MACMU
  • FullName:Cathelicidin antimicrobial peptide
  • Source:Macaca mulatta
  • Mass:4100.9 Da
  • Sequence Length:37 aa
  • Isoelectric Point:11.86
  • Activity:Antibacterial
  • Sequence
        RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS
  • Function:Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002737    From 1 To 37 E-value: 0.000000000000002 Score: 72.8
        RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS
  • 2. L01A003239    From 1 To 37 E-value: 0.0000000000005 Score: 65.1
        RLGNFFRKAKEKIGRGLKKIGQKIKDFWGNLVPRTES
  • 3. L01A002750    From 1 To 37 E-value: 0.0000000000007 Score: 64.3
        RLGNFFRKAKKKIGRGLKKIGQKIKDFLGNLVPRTES
  • 4. L11A007841    From 2 To 37 E-value: 0.0000000006 Score: 54.7
        LGDFFRKVKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 5. L01A003237    From 1 To 37 E-value: 0.0000000006 Score: 54.7
        RLGGILRKAGEKIGGGLKKIGQKIKDFFGKLAPRTES

Structure

  •   Domains
  •   1  Name:Cathelicidin    Interpro Link:IPR001894
  •   2  Name:Cathelicidin_CS    Interpro Link:IPR018216
  •   3  Name:Cathlecidin_C    Interpro Link:IPR022746
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Welsch U.,Vogelmeier C.,Weiner D.J.,Lang C.,Bals R.,
  •   Title:Rhesus monkey (Macaca mulatta) mucosal antimicrobial peptides are close homologues of human molecules.
  •   Journal:Clin. Diagn. Lab. Immunol., 2001, 8, 370-375  [MEDLINE:21137962]
  •   [2]  Espiritu C.,Hong T.,Boo L.M.,Nguyen T.,Zhao C.,
  •   Title:RL-37, an alpha-helical antimicrobial peptide of the rhesus monkey.
  •   Journal:Antimicrob. Agents Chemother., 2001, 45, 2695-2702  [MEDLINE:21441139]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: