Record in detail
General Info
- lamp_id:L01A002737
- Name:CAMP_MACMU
- FullName:Cathelicidin antimicrobial peptide
- Source:Macaca mulatta
- Mass:4100.9 Da
- Sequence Length:37 aa
- Isoelectric Point:11.86
- Activity:Antibacterial
- Sequence
RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS - Function:Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.
Cross-Linking
- Cross-linking
- 1 Database:APD 676
- 2 Database:CAMP CAMPSQ1707
- 3 Database:DBAASP 1778
- 4 Database:dbAMP dbAMP_10572
- 5 Database:DRAMP DRAMP02622
- 6 Database:SATPdb satpdb20269
- 7 Database:Uniprot Q9GLV5
- 8 Database:AMD RL37_MACMU
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A002737 From 1 To 37 E-value: 0.000000000000002 Score: 72.8
RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS - 2. L01A003239 From 1 To 37 E-value: 0.0000000000005 Score: 65.1
RLGNFFRKAKEKIGRGLKKIGQKIKDFWGNLVPRTES - 3. L01A002750 From 1 To 37 E-value: 0.0000000000007 Score: 64.3
RLGNFFRKAKKKIGRGLKKIGQKIKDFLGNLVPRTES - 4. L11A007841 From 2 To 37 E-value: 0.0000000006 Score: 54.7
LGDFFRKVKEKIGKEFKRIVQRIKDFLRNLVPRTES - 5. L01A003237 From 1 To 37 E-value: 0.0000000006 Score: 54.7
RLGGILRKAGEKIGGGLKKIGQKIKDFFGKLAPRTES
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Welsch U.,Vogelmeier C.,Weiner D.J.,Lang C.,Bals R.,
- Title:Rhesus monkey (Macaca mulatta) mucosal antimicrobial peptides are close homologues of human molecules.
- Journal:Clin. Diagn. Lab. Immunol., 2001, 8, 370-375 [MEDLINE:21137962]
- [2] Espiritu C.,Hong T.,Boo L.M.,Nguyen T.,Zhao C.,
- Title:RL-37, an alpha-helical antimicrobial peptide of the rhesus monkey.
- Journal:Antimicrob. Agents Chemother., 2001, 45, 2695-2702 [MEDLINE:21441139]
Comments
- Comments
No comments found on LAMP database