Record in detail


General Info

  • lamp_id:L01A002781
  • Name:CCLA_CARML
  • FullName:Carnocyclin-A
  • Source:Carnobacterium maltaromaticum
  • Mass:5880 Da
  • Sequence Length:60 aa
  • Isoelectric Point:10.7
  • Activity:Antibacterial
  • Sequence
        LVAYGIAQGTAEKVVSLINAGLTVGSIISILGGVTVGLSGVFTAVKAAIAKQGIKKAIQL
  • Function:Cyclopeptide antibiotic that inhibits the growth of Gram-positive bacteria, but has no effect on the growth of Gram-negative bacteria.

Cross-Linking

  •   Cross-linking
  •   1  Database:APD  1168
  •   2  Database:CAMP  CAMPSQ813
  •   3  Database:DBAASP  3172
  •   4  Database:dbAMP  dbAMP_06070
  •   5  Database:DRAMP  DRAMP00170
  •   6  Database:Uniprot  B2MVM5
  •   7  Database:BAC  BAC148

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08466|    From 5 To 64 E-value: 3e-26 Score: 108
        LVAYGIAQGTAEKVVSLINAGLTVGSIISILGGVTVGLSGVFTAVKAAIAKQGIKKAIQL
  • 2. L01A002781    From 1 To 60 E-value: 4e-26 Score: 108
        LVAYGIAQGTAEKVVSLINAGLTVGSIISILGGVTVGLSGVFTAVKAAIAKQGIKKAIQL
  • 3. L13A022646    From 1 To 50 E-value: 2e-20 Score: 89.7
        LVAYGIAQGTAEKVVSLINAGLTVGSIISILGGVTVGLSGVFTAVKAAIA
  • 4. L12A06910|    From 4 To 61 E-value: 0.027 Score: 29.3
        LVATGMAAGVAKTIVNAVSAGMDIATALSLFSGAFTAAGGIMALIKKYAQKKLWKQLI
  • 5. L12A01439|    From 7 To 37 E-value: 0.031 Score: 28.9
        GISTAAAKKAIDIIDAASTIASIISLIGIVT

Structure

  •   Domains
  •   1  Name:Bacteriocin_uberolysin    Interpro Link:IPR020038
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zheng J.,Whittal R.M.,Garneau-Tsodikova S.,van Belkum M.J.,Martin-Visscher L.A.,
  •   Title:Isolation and characterization of carnocyclin a, a novel circular bacteriocin produced by Carnobacterium maltaromaticum UAL307.
  •   Journal:Appl. Environ. Microbiol., 2008, 74, 4756-4763  [PubMed:18552180]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: