Record in detail


General Info

  • lamp_id:L01A002785
  • Name:Enterocin B
  • FullName:Enterocin B
  • Source:Enterococcus faecium T136
  • Mass:5450.2 Da
  • Sequence Length:53 aa
  • Isoelectric Point:10.05
  • Activity:Antibacterial
  • Sequence
        ENDHRMPNNLNRPNNLSKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYSKCN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08958|    From 19 To 71 E-value: 5e-26 Score: 108
        ENDHRMPNELNRPNNLSKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYSKCN
  • 2. L01A002785    From 1 To 53 E-value: 7e-26 Score: 107
        ENDHRMPNNLNRPNNLSKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYSKCN
  • 3. L04ABAC101    From 1 To 53 E-value: 2e-25 Score: 105
        ENDHRMPNELNRPNNLSKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYSKCN
  • 4. L13A028069    From 1 To 50 E-value: 6e-24 Score: 101
        ENDHRMPNNLNRPNNLSKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYS
  • 5. L12A01471|    From 1 To 28 E-value: 0.0000000005 Score: 54.7
        ENDHRMPYELNRPNNLSKGGAKCGAAIA

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: