Record in detail


General Info

  • lamp_id:L01A002789
  • Name:Enterocin RJ-11
  • FullName:Enterocin RJ-11
  • Source:Enterococcus faecalis RJ-11
  • Mass:5049.1 Da
  • Sequence Length:44 aa
  • Isoelectric Point:11.35
  • Activity:Antibacterial
  • Sequence
        APAGLVAKFGRPIVKKYYKQIMQFIGEGSAINKIIPWIARMWRT
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002789    From 1 To 44 E-value: 1e-20 Score: 90.5
        APAGLVAKFGRPIVKKYYKQIMQFIGEGSAINKIIPWIARMWRT
  • 2. L02A001191    From 3 To 42 E-value: 0.000000000002 Score: 63.2
        AIAKLVAKFGWPIVKKYYKQIMQFIGEGWAINKIIDWIKK
  • 3. L01A002791    From 3 To 42 E-value: 0.000000000002 Score: 63.2
        AIAKLVAKFGWPIVKKYYKQIMQFIGEGWAINKIIEWIKK
  • 4. L13A026080    From 3 To 42 E-value: 0.000000003 Score: 52.4
        AIAKLVAKFGWPFIKKFYKQIMQFIGQGWTIDQIEKWLKR
  • 5. L01A002790    From 3 To 42 E-value: 0.000000004 Score: 52
        AIAKLVTKFGWPLIKKFYKQIMQFIGQGWTIDQIEKWLKR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: