Record in detail


General Info

  • lamp_id:L01A002818
  • Name:APOA2_BOVIN
  • FullName:Apolipoprotein A-II
  • Source:Bos taurus
  • Mass:8566.5 Da
  • Sequence Length:76 aa
  • Isoelectric Point:4.71
  • Activity:Antibacterial, Antifungal
  • Sequence
        QAEESNLQSLVSQYFQTVADYGKDLVEKAKGSELQTQAKAYFEKTQEELTPFFKKAGTDLLNFLSSFIDPKKQPAT
  • Function:May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism. Has antimicrobial activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002818    From 1 To 76 E-value: 4e-39 Score: 151
        QAEESNLQSLVSQYFQTVADYGKDLVEKAKGSELQTQAKAYFEKTQEELTPFFKKAGTDLLNFLSSFIDPKKQPAT
  • 2. L01A002737    From 5 To 32 E-value: 2.2 Score: 22.7
        FFRKVKEKIGGGLKKVGQKIKDFLGNLV
  • 3. L01A003251    From 4 To 31 E-value: 6.9 Score: 21.2
        GFLQKAREKIARGFKKIGQKINDFLGKL

Structure

  •   Domains
  •   1  Name:ApoA-II    Interpro Link:IPR006801
  •   2  Name:ApoA/E_ApoLp    Interpro Link:IPR013326
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Tsurugi K.,Shimamura S.,Yamada M.,Itoh T.,Motizuki M.,
  •   Title:Purification, primary structure, and antimicrobial activities of bovine apolipoprotein A-II.
  •   Journal:J. Biochem., 1998, 123, 675-679  [MEDLINE:98207057]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: