Record in detail


General Info

  • lamp_id:L01A002828
  • Name:CASA2_BOVIN
  • FullName:Alpha-S2-casein
  • Source:Bos taurus
  • Mass:4869.7 Da
  • Sequence Length:39 aa
  • Isoelectric Point:10.71
  • Activity:Antibacterial
  • Sequence
        KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK
  • Function:Important role in the capacity of milk to transport calcium phosphate.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002828    From 1 To 39 E-value: 6e-17 Score: 77.8
        KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK
  • 2. L12A11446|    From 1 To 31 E-value: 0.000000000003 Score: 62.4
        TKLTEEEKNRLNFLKKISQRYQKFALPQYLK
  • 3. L11A010933    From 1 To 25 E-value: 0.000000005 Score: 51.6
        LKKISQRYQKFALPQYLKTVYQHQK
  • 4. L11A008379    From 1 To 22 E-value: 0.0000005 Score: 45.1
        TKLTEEEKNRLNFLKKISQRYQ
  • 5. L11A007142    From 3 To 14 E-value: 0.49 Score: 25
        KTKLTEEEKNRL

Structure

  •   Domains
  •   1  Name:Casein    Interpro Link:IPR001588
  •   2  Name:Casein_alpha-s2    Interpro Link:IPR011175
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Das B.C.,Pelissier J.-P.,Mercier J.-C.,Ribadeau-Dumas B.,Brignon G.,
  •   Title:Complete amino acid sequence of bovine alphaS2-casein.
  •   Journal:FEBS Lett., 1977, 76, 274-279  [MEDLINE:77185633]
  •   [2]  Mahe M.-F.,Joudrier P.,Grosclaude F.,
  •   Title:A genetic and biochemical analysis of a polymorphism of bovine alpha S2-casein.
  •   Journal:J. Dairy Res., 1979, 46, 211-213  [MEDLINE:79239837]
  •   [3]  Willis I.M.,Shah F.,Beattie C.W.,Bonsing J.,Stewart A.F.,
  •   Title:Complete nucleotide sequences of bovine alpha S2- and beta-casein cDNAs: comparisons with related sequences in other species.
  •   Journal:Mol. Biol. Evol., 1987, 4, 231-241  [MEDLINE:88188989]
  •   [4]  Forssmann W.-G.,Meagert H.-J.,Adermann K.,Raida M.,Zucht H.-D.,
  •   Title:Casocidin-I: a casein-alpha s2 derived peptide exhibits antibacterial activity.
  •   Journal:FEBS Lett., 1995, 372, 185-188  [MEDLINE:96000204]
  •   [5]  Pallari H.M.,de Thonel A.,Ferraris S.E.,Kochin V.,Imanishi S.Y.,
  •   Title:Reference-facilitated phosphoproteomics: fast and reliable phosphopeptide validation by micro LC-ESI-Q-TOF MS/MS.
  •   Journal:Mol. Cell. Proteomics, 2007, 6, 1380-1391  [PubMed:17510049]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: