Record in detail


General Info

  • lamp_id:L01A002835
  • Name:DMS1_PACDA
  • FullName:Dermaseptin PD-1-5
  • Source:Pachymedusa dacnicolor
  • Mass:3022.6 Da
  • Sequence Length:30 aa
  • Isoelectric Point:10.33
  • Activity:Antibacterial
  • Sequence
        SLGSFMKGVGKGLATVGKIVADQFGKLLEA
  • Function:Possesses a potent antimicrobial activity against Gram-positive and Gram-negative bacteria. Probably acts by disturbing membrane functions with its amphipathic structure (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000080    From 45 To 74 E-value: 0.00000000003 Score: 58.9
        SLGSFMKGVGKGLATVGKIVADQFGKLLEA
  • 2. L01A002835    From 1 To 30 E-value: 0.00000000005 Score: 58.2
        SLGSFMKGVGKGLATVGKIVADQFGKLLEA
  • 3. L02A000907    From 1 To 30 E-value: 0.00000000006 Score: 58.2
        SLGSFMKGVGKGLATVGKIVADQFGKLLEA
  • 4. L02A000908    From 1 To 30 E-value: 0.00000000006 Score: 57.8
        SLGSFMKGVGKGLATVGKIVADQFGKLLEA
  • 5. L03A000081    From 45 To 74 E-value: 0.00000004 Score: 48.5
        SLGSFLKGVGTTLASVGKVVSDQFGKLLQA

Structure

  •   Domains
  •   1  Name:Brevinin    Interpro Link:IPR004275
  •   2  Name:Dermaseptin_precursor    Interpro Link:IPR016322
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Wechselberger C.
  •   Title:Cloning of cDNAs encoding new peptides of the dermaseptin-family.
  •   Journal:Biochim. Biophys. Acta, 1998, 1388, 279-283  [MEDLINE:98449786]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: