Record in detail


General Info

  • lamp_id:L01A002839
  • Name:DMS3_PACDA
  • FullName:Dermaseptin PD-3-3
  • Source:Pachymedusa dacnicolor
  • Mass:3185.7 Da
  • Sequence Length:33 aa
  • Isoelectric Point:11.2
  • Activity:Antibacterial
  • Sequence
        GMWSKIKNAGKAAAKASKKAAGKAALGAVSEAL
  • Function:Possesses a potent antimicrobial activity against Gram-positive and Gram-negative bacteria. Probably acts by disturbing membrane functions with its amphipathic structure (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000084    From 45 To 77 E-value: 0.00000000001 Score: 60.1
        GMWSKIKNAGKAAAKASKKAAGKAALGAVSEAL
  • 2. L01A002839    From 1 To 33 E-value: 0.00000000007 Score: 57.8
        GMWSKIKNAGKAAAKASKKAAGKAALGAVSEAL
  • 3. L03A000083    From 46 To 77 E-value: 0.00003 Score: 39.3
        GMWSTIRNVGKSAAKAANLPA-KAALGAISEAV
  • 4. L01A002844    From 1 To 32 E-value: 0.00003 Score: 38.9
        GMWSTIRNVGKSAAKAANLPA-KAALGAISEAV
  • 5. L02A000937    From 1 To 29 E-value: 0.0003 Score: 35.8
        GLWSKIKEAGKAVL----TAAGKAALGAVSDAV

Structure

  •   Domains
  •   1  Name:Brevinin    Interpro Link:IPR004275
  •   2  Name:Dermaseptin    Interpro Link:IPR022731
  •   3  Name:Dermaseptin_precursor    Interpro Link:IPR016322
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Wechselberger C.
  •   Title:Cloning of cDNAs encoding new peptides of the dermaseptin-family.
  •   Journal:Biochim. Biophys. Acta, 1998, 1388, 279-283  [MEDLINE:98449786]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: