Record in detail


General Info

  • lamp_id:L01A002844
  • Name:DMS6_AGAAN
  • FullName:Dermaseptin AA-3-6
  • Source:Agalychnis annae
  • Mass:3154.6 Da
  • Sequence Length:32 aa
  • Isoelectric Point:11.08
  • Activity:Antibacterial
  • Sequence
        GMWSTIRNVGKSAAKAANLPAKAALGAISEAV
  • Function:Possesses a potent antimicrobial activity against Gram-positive and Gram-negative bacteria. Probably acts by disturbing membrane functions with its amphipathic structure (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000083    From 46 To 77 E-value: 0.0000000000006 Score: 64.7
        GMWSTIRNVGKSAAKAANLPAKAALGAISEAV
  • 2. L01A002844    From 1 To 32 E-value: 0.000000000004 Score: 62
        GMWSTIRNVGKSAAKAANLPAKAALGAISEAV
  • 3. L12A05358|    From 41 To 67 E-value: 0.001 Score: 33.9
        GLWSTIKNVGKEAAIAA---GKAVLGSLGE
  • 4. L02A001352    From 1 To 27 E-value: 0.002 Score: 33.1
        GLWSTIKNVGKEAAIAA---GKAVLGSLGE
  • 5. L01A003280    From 1 To 25 E-value: 0.008 Score: 31.2
        GLWSTIKNVGKEAAIAA---GKAVLGSL

Structure

  •   Domains
  •   1  Name:Brevinin    Interpro Link:IPR004275
  •   2  Name:Dermaseptin_precursor    Interpro Link:IPR016322
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Wechselberger C.
  •   Title:Cloning of cDNAs encoding new peptides of the dermaseptin-family.
  •   Journal:Biochim. Biophys. Acta, 1998, 1388, 279-283  [MEDLINE:98449786]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: