Record in detail


General Info

  • lamp_id:L01A002846
  • Name:DRG3_PHYBI
  • FullName:Dermaseptin DRG3
  • Source:Phyllomedusa bicolor
  • Mass:3111.7 Da
  • Sequence Length:30 aa
  • Isoelectric Point:10.8
  • Activity:Antibacterial
  • Sequence
        ALWKTIIKGAGKMIGSLAKNLLGSQAQPES
  • Function:Has antimicrobial activity. Exhibits a bactericidal activity towards several species of mollicutes, firmicutes and gracilicutes. This peptide is membranotropic and it efficiently depolarizes the plasma membrane.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06197|    From 46 To 75 E-value: 0.000000000003 Score: 62.4
        ALWKTIIKGAGKMIGSLAKNLLGSQAQPES
  • 2. L03A000085    From 46 To 75 E-value: 0.000000000003 Score: 62.4
        ALWKTIIKGAGKMIGSLAKNLLGSQAQPES
  • 3. L01A002846    From 1 To 30 E-value: 0.00000000002 Score: 60.1
        ALWKTIIKGAGKMIGSLAKNLLGSQAQPES
  • 4. L01A002485    From 24 To 53 E-value: 0.00000007 Score: 47.8
        ALWKTLLKGAGKVFGHVAKQFLGSQGQPES
  • 5. L02A000939    From 1 To 30 E-value: 0.00000007 Score: 47.8
        ALWKTLLKGAGKVFGHVAKQFLGSQGQPES

Structure

  •   Domains
  •   1  Name:Brevinin    Interpro Link:IPR004275
  •   2  Name:Dermaseptin_precursor    Interpro Link:IPR016322
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  mollicutes  MIC:  311.17 μg/ml  (100 μM)  
  •   2  Target:  firmicutes  MIC:  311.17 μg/ml  (100 μM)  
  •   3  Target:  gracilicutes  MIC:  311.17 μg/ml  (100 μM)  
  •   4  Target:  E. coli  MIC:  155.585 μg/ml  (50 μM)  
  •   5  Target:  S. aureus  MIC:  155.585 μg/ml  (50 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Wroblewski H.,Amiche M.,Beven L.,Vouille V.,Fleury Y.,
  •   Title:Synthesis, antimicrobial activity and gene structure of a novel member of the dermaseptin B family.
  •   Journal:Biochim. Biophys. Acta, 1998, 1396, 228-236  [MEDLINE:98201715]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: