Record in detail
General Info
- lamp_id:L01A002846
- Name:DRG3_PHYBI
- FullName:Dermaseptin DRG3
- Source:Phyllomedusa bicolor
- Mass:3111.7 Da
- Sequence Length:30 aa
- Isoelectric Point:10.8
- Activity:Antibacterial
- Sequence
ALWKTIIKGAGKMIGSLAKNLLGSQAQPES - Function:Has antimicrobial activity. Exhibits a bactericidal activity towards several species of mollicutes, firmicutes and gracilicutes. This peptide is membranotropic and it efficiently depolarizes the plasma membrane.
Cross-Linking
- Cross-linking
- 1 Database:APD 164
- 2 Database:CAMP CAMPSQ850
- 3 Database:DBAASP 3007
- 4 Database:dbAMP dbAMP_00385
- 5 Database:DRAMP DRAMP01657
- 6 Database:SATPdb satpdb20693
- 7 Database:Uniprot P81488
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A06197| From 46 To 75 E-value: 0.000000000003 Score: 62.4
ALWKTIIKGAGKMIGSLAKNLLGSQAQPES - 2. L03A000085 From 46 To 75 E-value: 0.000000000003 Score: 62.4
ALWKTIIKGAGKMIGSLAKNLLGSQAQPES - 3. L01A002846 From 1 To 30 E-value: 0.00000000002 Score: 60.1
ALWKTIIKGAGKMIGSLAKNLLGSQAQPES - 4. L01A002485 From 24 To 53 E-value: 0.00000007 Score: 47.8
ALWKTLLKGAGKVFGHVAKQFLGSQGQPES - 5. L02A000939 From 1 To 30 E-value: 0.00000007 Score: 47.8
ALWKTLLKGAGKVFGHVAKQFLGSQGQPES
Activity
- Antibacterial Activities
- 1 Target: mollicutes MIC: 311.17 μg/ml (100 μM)
- 2 Target: firmicutes MIC: 311.17 μg/ml (100 μM)
- 3 Target: gracilicutes MIC: 311.17 μg/ml (100 μM)
- 4 Target: E. coli MIC: 155.585 μg/ml (50 μM)
- 5 Target: S. aureus MIC: 155.585 μg/ml (50 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Wroblewski H.,Amiche M.,Beven L.,Vouille V.,Fleury Y.,
- Title:Synthesis, antimicrobial activity and gene structure of a novel member of the dermaseptin B family.
- Journal:Biochim. Biophys. Acta, 1998, 1396, 228-236 [MEDLINE:98201715]
Comments
- Comments
No comments found on LAMP database