Record in detail


General Info

  • lamp_id:L01A002852
  • Name:H2A_HIPHI
  • FullName:Histone H2A
  • Source:Hippoglossus hippoglossus
  • Mass:5416.3 Da
  • Sequence Length:51 aa
  • Isoelectric Point:12.74
  • Activity:Antibacterial
  • Sequence
        SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYL
  • Function:Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09319|    From 2 To 52 E-value: 2e-23 Score: 99.4
        SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYL
  • 2. L01A002852    From 1 To 51 E-value: 3e-23 Score: 99
        SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYL
  • 3. L13A011761    From 1 To 50 E-value: 1e-22 Score: 97.1
        SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVY
  • 4. L12A11015|    From 1 To 51 E-value: 1e-22 Score: 96.7
        SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYL
  • 5. L12A11014|    From 1 To 50 E-value: 4e-22 Score: 94.7
        SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVY

Structure

  •   Domains
  •   1  Name:Histone-fold    Interpro Link:IPR009072
  •   2  Name:Histone_core_D    Interpro Link:IPR007125
  •   3  Name:Histone_H2A    Interpro Link:IPR002119
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  gram+  MIC:  1.62 μg/ml  (0.299097 μM)  
  •   2  Target:  gram-  MIC:  1.62 μg/ml  (0.299097 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Nissen-Meyer J.,Nes I.F.,Andersen O.,Lueders T.,Birkemo G.A.,
  •   Title:Hipposin, a histone-derived antimicrobial peptide in Atlantic halibut (Hippoglossus hippoglossus L.).
  •   Journal:Biochim. Biophys. Acta, 2003, 1646, 207-215  [MEDLINE:22523727]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: