Record in detail


General Info

  • lamp_id:L01A002865
  • Name:DEF2_VICFA
  • FullName:Defensin-like protein 2
  • Source:Vicia faba
  • Mass:5206.1 Da
  • Sequence Length:47 aa
  • Isoelectric Point:8.8
  • Activity:Antibacterial
  • Sequence
        LLGRCKVKSNRFNGPCLTDTHCSTVCRGEGYKGGDCHGLRRRCMCLC
  • Function:Fabatins have antibacterial activity against Gram-positive and Gram-negative bacteria. High activity against P.aeruginosa. No activity against S.cerevisiae and C.albicans.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002865    From 1 To 47 E-value: 3e-22 Score: 95.1
        LLGRCKVKSNRFNGPCLTDTHCSTVCRGEGYKGGDCHGLRRRCMCLC
  • 2. L01A000420    From 1 To 47 E-value: 1e-21 Score: 93.2
        LLGRCKVKSNRFHGPCLTDTHCSTVCRGEGYKGGDCHGLRRRCMCLC
  • 3. L05ADEF280    From 32 To 72 E-value: 0.00000000008 Score: 57.8
        CETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLC
  • 4. L12A06371|    From 34 To 74 E-value: 0.0000000002 Score: 56.2
        CESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRCFC
  • 5. L06AT00035    From 3 To 43 E-value: 0.0000000003 Score: 55.5
        CETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLC

Structure

  •   Domains
  •   1  Name:G_Purothionin    Interpro Link:IPR008177
  •   2  Name:Gamma-thionin    Interpro Link:IPR008176
  •   3  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lewis K.,Zhang Y.,
  •   Title:Fabatins: new antimicrobial plant peptides.
  •   Journal:FEMS Microbiol. Lett., 1997, 149, 59-64  [MEDLINE:97257504]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: