Record in detail
General Info
- lamp_id:L01A002884
- Name:RK1_RABIT
- FullName:Corticostatin-related peptide RK-1
- Source:Oryctolagus cuniculus
- Mass:3707.3 Da
- Sequence Length:32 aa
- Isoelectric Point:7.73
- Activity:Antibacterial
- Sequence
MPCSCKKYCDPWEVIDGSCGLFNSKYICCREK - Function:Has antimicrobial activity against E.coli and activates ion channel activity.
Cross-Linking
- Cross-linking
- 1 Database:APD 149
- 2 Database:CAMP CAMPSQ873
- 3 Database:dbAMP dbAMP_08888
- 4 Database:DRAMP DRAMP03798
- 5 Database:SATPdb satpdb20420
- 6 Database:Uniprot P81655
- 7 Database:AMD RK1_RABIT
- 8 Database:DEF DEF244
- 9 Database:RAP RAPD0147
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A002884 From 1 To 32 E-value: 0.00000000000004 Score: 68.6
MPCSCKKYCDPWEVIDGSCGLFNSKYICCREK - 2. L12A06310| From 53 To 77 E-value: 1.9 Score: 23.1
CRKECLENEKPDGSCRL---NFLCCRQR - 3. L12A06309| From 53 To 77 E-value: 2 Score: 23.1
CRKECLENEKPDGSCRL---NFLCCRQR - 4. L12A03264| From 26 To 50 E-value: 2.1 Score: 23.1
CRKECLENEKPDGSCRL---NFLCCRQR - 5. L12A03263| From 26 To 50 E-value: 2.1 Score: 23.1
CRKECLENEKPDGSCRL---NFLCCRQR
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Esch F.,Hu J.,Lembessis P.,MacLeod R.J.,Bateman A.,
- Title:The isolation and characterization of a novel corticostatin/defensin-like peptide from the kidney.
- Journal:J. Biol. Chem., 1996, 271, 10654-10659 [MEDLINE:96209993]
- [2] Winzor D.J.,Carrington L.E.,Wade J.D.,Dawson N.F.,McManus A.M.,
- Title:Three-dimensional structure of RK-1: a novel alpha-defensin peptide.
- Journal:Biochemistry, 2000, 39, 15757-15764 [MEDLINE:20573568]
Comments
- Comments
No comments found on LAMP database